ALWAYSSADANDUGLYIN ALWAYSSADANDUGLYIN

Math

Answered

pa help.<:
please ,, thanks

Pa Helplt Please Thanks class=

Sagot :

P0L0P0IN P0L0P0IN

Answer:

Find the prime factors of each term in order to find the greatest common factor (GCF).

1. 2x is the GCF

2. 3m is the GCF

3. 2m is the GCF

Step-by-step explanation:

#CarryOnLearning

#RoadToGenius

Answer Link

In Studier: Other Questions

IsaisipSa Pagsulat Ng Anomang Uri Ng Teksto, Narito Ang Mga Batayang Tanong Namahalagang Masagot Mo Sa Paghahanda Nito.1. Ano Ang Paksa Ng Tekstong Aking Isusul

Mabubuod Ba Ang Piksyon

Which Of The Following Is Not True Abuot Heat

AB U BE=pls Help Me To Get The Answer

You Can Have The Pionts

Essay Abt I Am Sacrament Of God’s Love Or Poem Need Lang Po

Translate The Following Word Phrases Into Algebraic Expressions.6. Five More Than X7. Eight Added To Z8. Seven Subtracted From K9. M Increased By Ten10. Twice Y

Magbigay Ng Tigilsang Hindi Makatotohanang Pangyayari Sa Bawat Kuwento? 

Find The Next Three Terms In Each Sequence. Then, Write The Rule For Finding The Nth Term. ⅔, ¾, ⅘, __, __, __Rule:_______________________

1. What Is The Difference Between Triangle And Rectangle According Toangles?

II. Punan Ng Tamang Salita Ang Mga Patlang Upang Mabuo Ang Mga Pangungusap. Pumili Ng Sagot Sa Loob Ngkahon.kahusayanmasipagkatawanpag-iisipisipnaisasakatuparan

Synthesizing The Concept And Give Your Personal Definition Of Globalization